PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca28783.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 146aa    MW: 17258.6 Da    PI: 8.62
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca28783.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.35e-5681371129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 +ppGfrFhPtdeelv +yLkkk++++k++l +vi+++d+y++ePwdL++     ++e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v++ k
  Dca28783.1   8 VPPGFRFHPTDEELVGYYLKKKIASQKIDL-DVIRDIDLYRIEPWDLQErcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATLAGFWKATGRDKAVYD-K 104
                 69****************************.9***************953432233667**************************************.9 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrle 129
                 ++l+g++ktLvfykgrap+g+k+dW+mheyrle
  Dca28783.1 105 SKLIGMRKTLVFYKGRAPNGHKSDWIMHEYRLE 137
                 99*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-576141IPR003441NAC domain
PROSITE profilePS5100554.9398146IPR003441NAC domain
PfamPF023652.1E-299136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MDSMESCVPP GFRFHPTDEE LVGYYLKKKI ASQKIDLDVI RDIDLYRIEP WDLQERCRIG  60
YEEQNEWYFF SHKDKKYPTG TRTNRATLAG FWKATGRDKA VYDKSKLIGM RKTLVFYKGR  120
APNGHKSDWI MHEYRLESDE NGPPQA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-50513612140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003612138.11e-103transcription factor
RefseqXP_010649056.11e-103PREDICTED: NAC domain-containing protein 7 isoform X1
SwissprotQ9SL411e-101NAC37_ARATH; NAC domain-containing protein 37
TrEMBLF6GWP21e-104F6GWP2_VITVI; Putative uncharacterized protein
TrEMBLI6XH451e-104I6XH45_9CARY; NAC domain-containing protein
STRINGVIT_04s0023g03110.t011e-103(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-102vascular related NAC-domain protein 1